PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009533
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 501aa    MW: 55258.7 Da    PI: 10.4339
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009533genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.18.4e-2582126145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+
  Lus10009533  82 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVES 126
                  79****************************************997 PP

2QLQ651.8e-222056137
          QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 s+FT +Q+q+L++Q+l+yKy++a++PvPp+L+++iqk
  Lus10009533 20 SPFTVSQWQELEHQALIYKYMMAGGPVPPDLMLPIQK 56
                 89*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.4E-142056IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-142155IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.912156IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.76282126IPR014977WRC domain
PfamPF088796.7E-2183125IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MSSGGGGGSG GTSTVTMMRS PFTVSQWQEL EHQALIYKYM MAGGPVPPDL MLPIQKSFDS  60
ISPSFFHHPS LGYCSFYGKK VDPEPGRCRR TDGKKWRCSK DAYPDSKYCE RHMHRGRNRS  120
RKPVESSSQQ TTIITQSSTA MTPTAAGTVV IDNNSGIGGF HHHAFANPVS GNNQSPYHHH  180
LESIPYAIPS KDYSSRYLQG VKAEASSNRG NFVNNEDSSA WPLMQSRVSP SSFSTSKSTP  240
MNDYSSNQSF LNFAEPAEKQ HESQSLRPFF DEWPKTRGGG GGESWSGLDH HDDSSRSNAS  300
FSSTTQLSIS IPTMASPDMI STSSRSSPNR TIKSLNTRTT NALRASVTRE PSTDSSLPPR  360
AIEPPRRAIR RGTDSVHIRA QDSPHQRIRR TVSKNCTALD QSTVSGGWIA TKIASFLPVW  420
SVTAGAPCLA WRERRNGSSP ERKCRRFPMN GSLVGPGGRV GFPAEEDEKR LMKNLRRKLI  480
ERETRIKNKK SSIVVIFEVH *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3824882e-63FQ382488.1 Vitis vinifera clone SS0ABG55YD19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470089.11e-116PREDICTED: growth-regulating factor 4-like
TrEMBLA0A0B0N4371e-119A0A0B0N437_G
STRINGVIT_16s0039g01450.t011e-105(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47812951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-45growth-regulating factor 5